SCOPe 2.06: Domain d4fqxa1: 4fqx A:2-81

Lineage for d4fqxa1 (4fqx A:2-81)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d4fqxa1: 4fqx A:2-81 [221466]
   Other proteins in same PDB: d4fqxa2, d4fqxb1, d4fqxb2, d4fqxb3, d4fqxc1, d4fqxc2, d4fqxc3, d4fqxd1, d4fqxd2
   automated match to d1fnga2

Details for d4fqxa1

PDB Entry: 4fqx, 2.6 Å

PDB Description: crystal structure of hla-dm bound to hla-dr1

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4fqxa1:

Sequence; same for both SEQRES and ATOM records:

>d4fqxa1 d.19.1.0 (A:2-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niacdkanleimtkrsnytp

Timeline for d4fqxa1:

• d4fqxa1 first appeared in SCOPe 2.03
  
• d4fqxa1 appears in SCOPe 2.05
  
• d4fqxa1 appears in SCOPe 2.07
  
• d4fqxa1 appears in the current release, SCOPe 2.08