Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries) |
Domain d4fqxa1: 4fqx A:2-81 [221466] Other proteins in same PDB: d4fqxa2, d4fqxb1, d4fqxb2, d4fqxc1, d4fqxc2, d4fqxd1, d4fqxd2 automated match to d1fnga2 |
PDB Entry: 4fqx (more details), 2.6 Å
SCOPe Domain Sequences for d4fqxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fqxa1 d.19.1.0 (A:2-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala niacdkanleimtkrsnytp
Timeline for d4fqxa1: