SCOPe 2.03: Domain d4fqql2: 4fqq L:109-212

Lineage for d4fqql2 (4fqq L:109-212)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
Domain d4fqql2: 4fqq L:109-212 [221463]
Other proteins in same PDB: d4fqqa1, d4fqqc1, d4fqqe1, d4fqql1
automated match to d1adql2
complexed with na

Details for d4fqql2

PDB Entry: 4fqq (more details), 2.42 Å

PDB Description: crystal structure of germline antibody pgt121-gl fab

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4fqql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqql2 b.1.1.2 (L:109-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d4fqql2:

Click to download the PDB-style file with coordinates for d4fqql2.
(The format of our PDB-style files is described here.)

Timeline for d4fqql2: