Lineage for d4fqjl2 (4fqj L:108-211)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294295Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
  8. 1294663Domain d4fqjl2: 4fqj L:108-211 [221453]
    Other proteins in same PDB: d4fqjl1
    automated match to d1mcww2

Details for d4fqjl2

PDB Entry: 4fqj (more details), 2.5 Å

PDB Description: influenza b/florida/4/2006 hemagglutinin fab cr8071 complex
PDB Compounds: (L:) antibody CR8071 light chain

SCOPe Domain Sequences for d4fqjl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqjl2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d4fqjl2:

Click to download the PDB-style file with coordinates for d4fqjl2.
(The format of our PDB-style files is described here.)

Timeline for d4fqjl2: