SCOPe 2.04: Domain d4fqhl2: 4fqh L:108-209

Lineage for d4fqhl2 (4fqh L:108-209)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d4fqhl2: 4fqh L:108-209 [221451]
   Other proteins in same PDB: d4fqhb1, d4fqhl1
   automated match to d2fb4l2
   complexed with edo, no3

Details for d4fqhl2

PDB Entry: 4fqh, 2.05 Å

PDB Description: crystal structure of fab cr9114

PDB Compounds: (L:) Antibody CR9114 light chain

SCOPe Domain Sequences for d4fqhl2:

Sequence; same for both SEQRES and ATOM records:

>d4fqhl2 b.1.1.2 (L:108-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d4fqhl2:

• d4fqhl2 first appeared in SCOPe 2.03
  
• d4fqhl2 appears in SCOPe 2.05
  
• d4fqhl2 appears in the current release, SCOPe 2.08