Lineage for d4fqcl2 (4fqc L:109-209)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296266Domain d4fqcl2: 4fqc L:109-209 [221447]
    automated match to d1etza2
    complexed with tam

Details for d4fqcl2

PDB Entry: 4fqc (more details), 2.4 Å

PDB Description: crystal structure of pgt121 fab bound to a complex-type sialylated n- glycan
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4fqcl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqcl2 b.1.1.0 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d4fqcl2:

Click to download the PDB-style file with coordinates for d4fqcl2.
(The format of our PDB-style files is described here.)

Timeline for d4fqcl2: