Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [226244] (12 PDB entries) |
Domain d4fq8a2: 4fq8 A:105-263 [221443] Other proteins in same PDB: d4fq8a1, d4fq8b1 automated match to d1p77a1 complexed with skm; mutant |
PDB Entry: 4fq8 (more details), 2.07 Å
SCOPe Domain Sequences for d4fq8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fq8a2 c.2.1.0 (A:105-263) automated matches {Helicobacter pylori [TaxId: 85962]} dalgfylslkqknyqnalilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdc fmeppksafdliinatsaslhnelplnkevlkgyfkegklaydlaagfltpflslakelk tpfqdgkdmliyqaalsfekfsasqipyskafevmrsvf
Timeline for d4fq8a2: