SCOPe 2.03: Domain d4fq2l1: 4fq2 L:8-108

Lineage for d4fq2l1 (4fq2 L:8-108)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d4fq2l1: 4fq2 L:8-108 [221440]
   Other proteins in same PDB: d4fq2l2
   automated match to d1lila1
   complexed with 144, edo

Details for d4fq2l1

PDB Entry: 4fq2, 1.9 Å

PDB Description: crystal structure of 10-1074 fab

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4fq2l1:

Sequence; same for both SEQRES and ATOM records:

>d4fq2l1 b.1.1.0 (L:8-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrplsvalgetariscgrqalgsravqwyqhrpgqapilliynnqdrpsgiperfsgtpd
infgtratltisgveagdeadyychmwdsrsgfswsfggatrltvlg

Timeline for d4fq2l1:

• d4fq2l1 is new in SCOPe 2.03-stable
  
• d4fq2l1 appears in SCOPe 2.04
  
• d4fq2l1 appears in the current release, SCOPe 2.08