Lineage for d4fpza_ (4fpz A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233472Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2233473Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2233474Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2233636Protein automated matches [190420] (8 species)
    not a true protein
  7. 2233663Species Momordica balsamina [TaxId:3672] [189375] (74 PDB entries)
  8. 2233680Domain d4fpza_: 4fpz A: [221439]
    automated match to d3mrwa_
    complexed with nag, ura

Details for d4fpza_

PDB Entry: 4fpz (more details), 1.7 Å

PDB Description: crystal structure of ribosome inactivating protein (rip) from momordica balsamina with uracil at 1.7 angstrom resolution
PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4fpza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fpza_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d4fpza_:

Click to download the PDB-style file with coordinates for d4fpza_.
(The format of our PDB-style files is described here.)

Timeline for d4fpza_: