Lineage for d4fopa_ (4fop A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142123Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2142137Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2142138Protein automated matches [193326] (10 species)
    not a true protein
  7. 2142139Species Acinetobacter baumannii [TaxId:575584] [196867] (16 PDB entries)
  8. 2142150Domain d4fopa_: 4fop A: [221409]
    automated match to d4jy7a_
    complexed with act, gol, peg

Details for d4fopa_

PDB Entry: 4fop (more details), 1.86 Å

PDB Description: Crystal Structure of Peptidyl-tRNA hydrolase from Acinetobacter baumannii at 1.86 A resolution
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4fopa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fopa_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

SCOPe Domain Coordinates for d4fopa_:

Click to download the PDB-style file with coordinates for d4fopa_.
(The format of our PDB-style files is described here.)

Timeline for d4fopa_: