SCOPe 2.03: Domain d4fopa_: 4fop A:

Lineage for d4fopa_ (4fop A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (5 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (11 PDB entries)

8. Domain d4fopa_: 4fop A: [221409]
   automated match to d4jy7a_
   complexed with act, gol, peg

Details for d4fopa_

PDB Entry: 4fop, 1.86 Å

PDB Description: Crystal Structure of Peptidyl-tRNA hydrolase from Acinetobacter baumannii at 1.86 A resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4fopa_:

Sequence; same for both SEQRES and ATOM records:

>d4fopa_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

Timeline for d4fopa_:

• d4fopa_ is new in SCOPe 2.03-stable
  
• d4fopa_ appears in SCOPe 2.04
  
• d4fopa_ appears in the current release, SCOPe 2.08