SCOPe 2.03: Domain d4fnke_: 4fnk E:

Lineage for d4fnke_ (4fnk E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (6 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)

8. Domain d4fnke_: 4fnk E: [221369]
   automated match to d2viua_
   complexed with gol, nag, so4

Details for d4fnke_

PDB Entry: 4fnk, 1.9 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4fnke_:

Sequence; same for both SEQRES and ATOM records:

>d4fnke_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpek

Timeline for d4fnke_:

• d4fnke_ is new in SCOPe 2.03-stable
  
• d4fnke_ appears in SCOPe 2.04
  
• d4fnke_ appears in the current release, SCOPe 2.08, called d4fnke1