Lineage for d1ghok2 (1gho K:626-730)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1521824Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1521825Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1521839Species Escherichia coli [TaxId:562] [49306] (41 PDB entries)
    Uniprot P00722
  8. 1522077Domain d1ghok2: 1gho K:626-730 [22134]
    Other proteins in same PDB: d1ghoi3, d1ghoi4, d1ghoi5, d1ghoj3, d1ghoj4, d1ghoj5, d1ghok3, d1ghok4, d1ghok5, d1ghol3, d1ghol4, d1ghol5, d1ghom3, d1ghom4, d1ghom5, d1ghon3, d1ghon4, d1ghon5, d1ghoo3, d1ghoo4, d1ghoo5, d1ghop3, d1ghop4, d1ghop5
    complexed with mg

Details for d1ghok2

PDB Entry: 1gho (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)
PDB Compounds: (K:) beta-galactosidase

SCOPe Domain Sequences for d1ghok2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghok2 b.1.4.1 (K:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d1ghok2:

Click to download the PDB-style file with coordinates for d1ghok2.
(The format of our PDB-style files is described here.)

Timeline for d1ghok2: