Lineage for d4fm5a1 (4fm5 A:32-72)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031550Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 3031551Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)
  8. 3031568Domain d4fm5a1: 4fm5 A:32-72 [221275]
    Other proteins in same PDB: d4fm5a2, d4fm5b2, d4fm5c2, d4fm5d2
    automated match to d1pxxa2
    complexed with bog, df0, hem

Details for d4fm5a1

PDB Entry: 4fm5 (more details), 2.81 Å

PDB Description: x-ray structure of des-methylflurbiprofen bound to murine cox-2
PDB Compounds: (A:) Prostaglandin G/H synthase 2

SCOPe Domain Sequences for d4fm5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fm5a1 g.3.11.1 (A:32-72) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d4fm5a1:

Click to download the PDB-style file with coordinates for d4fm5a1.
(The format of our PDB-style files is described here.)

Timeline for d4fm5a1: