SCOPe 2.03: Domain d4flra2: 4flr A:555-628

Lineage for d4flra2 (4flr A:555-628)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (18 species)
   not a true protein

7. Species Neisseria polysaccharea [TaxId:489] [226281] (5 PDB entries)

8. Domain d4flra2: 4flr A:555-628 [221272]
   Other proteins in same PDB: d4flra1
   automated match to d1g5aa1
   complexed with 1pe, gol, trs; mutant

Details for d4flra2

PDB Entry: 4flr, 2.4 Å

PDB Description: Crystal structure of Amylosucrase double mutant A289P-F290L from Neisseria polysaccharea

PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d4flra2:

Sequence; same for both SEQRES and ATOM records:

>d4flra2 b.71.1.0 (A:555-628) automated matches {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

Timeline for d4flra2:

• d4flra2 is new in SCOPe 2.03-stable
  
• d4flra2 appears in SCOPe 2.04
  
• d4flra2 appears in the current release, SCOPe 2.08