Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (31 species) not a true protein |
Species Neisseria polysaccharea [TaxId:489] [226280] (7 PDB entries) |
Domain d4flqa1: 4flq A:5-554 [221269] Other proteins in same PDB: d4flqa2, d4flqa3 automated match to d1g5aa2 complexed with gol, pg4, pge, trs; mutant |
PDB Entry: 4flq (more details), 2.5 Å
SCOPe Domain Sequences for d4flqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4flqa1 c.1.8.1 (A:5-554) automated matches {Neisseria polysaccharea [TaxId: 489]} qylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpmleml laqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkipyfqe lgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisavvdfi fnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsqledgr wvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavpiiwkqmgtscenlpq ahalirafnavmriaapavffkseaivhpdqvvqyigqdecqigynplqmallwntlatr evnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnrffvn rfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgglpli ylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrhmiav rqsnprfdgg
Timeline for d4flqa1: