Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (25 species) not a true protein |
Species Neisseria polysaccharea [TaxId:489] [226280] (6 PDB entries) |
Domain d4floa1: 4flo A:5-554 [221267] Other proteins in same PDB: d4floa2, d4floa3 automated match to d1g5aa2 complexed with gol, p6g, trs; mutant |
PDB Entry: 4flo (more details), 2.2 Å
SCOPe Domain Sequences for d4floa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4floa1 c.1.8.1 (A:5-554) automated matches {Neisseria polysaccharea [TaxId: 489]} qylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpmleml laqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkipyfqe lgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisavvdfi fnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsqledgr wvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavpciwkqmgtscenlpq ahalirafnavmriaapavffkseaivhpdqvvqyigqdecqigynplqmallwntlatr evnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnrffvn rfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgglpli ylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrhmiav rqsnprfdgg
Timeline for d4floa1: