Lineage for d4fjqa1 (4fjq A:17-218)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498423Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1498779Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1499100Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 1499101Protein automated matches [226931] (6 species)
    not a true protein
  7. 1499102Species Artemisia annua [TaxId:35608] [226616] (2 PDB entries)
  8. 1499103Domain d4fjqa1: 4fjq A:17-218 [221239]
    Other proteins in same PDB: d4fjqa2
    automated match to d1hxga1

Details for d4fjqa1

PDB Entry: 4fjq (more details), 2 Å

PDB Description: crystal structure of an alpha-bisabolol synthase
PDB Compounds: (A:) Amorpha-4,11-diene synthase

SCOPe Domain Sequences for d4fjqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fjqa1 a.102.4.0 (A:17-218) automated matches {Artemisia annua [TaxId: 35608]}
psiwgdqflivdnqveqgveqivkdlkkevrqllkealdipmkhanllklvdeiqrlgis
ylfeqeidhalqhiyetygdnwsgdrsslwfrlmrkqgyfvtcdvfnnhkdesgvfkqsl
knhvegllelyeatsmrvpgeiiledalvftqshlsiiakdtlsinpalsteiqralkkp
lwkrlprieavqyipfyeqqds

SCOPe Domain Coordinates for d4fjqa1:

Click to download the PDB-style file with coordinates for d4fjqa1.
(The format of our PDB-style files is described here.)

Timeline for d4fjqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fjqa2