Class a: All alpha proteins [46456] (285 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.0: automated matches [227201] (1 protein) not a true family |
Protein automated matches [226931] (6 species) not a true protein |
Species Artemisia annua [TaxId:35608] [226616] (2 PDB entries) |
Domain d4fjqa1: 4fjq A:17-218 [221239] Other proteins in same PDB: d4fjqa2 automated match to d1hxga1 |
PDB Entry: 4fjq (more details), 2 Å
SCOPe Domain Sequences for d4fjqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fjqa1 a.102.4.0 (A:17-218) automated matches {Artemisia annua [TaxId: 35608]} psiwgdqflivdnqveqgveqivkdlkkevrqllkealdipmkhanllklvdeiqrlgis ylfeqeidhalqhiyetygdnwsgdrsslwfrlmrkqgyfvtcdvfnnhkdesgvfkqsl knhvegllelyeatsmrvpgeiiledalvftqshlsiiakdtlsinpalsteiqralkkp lwkrlprieavqyipfyeqqds
Timeline for d4fjqa1: