Lineage for d4fj1d_ (4fj1 D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580539Species Cochliobolus lunatus [TaxId:5503] [225937] (9 PDB entries)
  8. 1580558Domain d4fj1d_: 4fj1 D: [221234]
    automated match to d3uvea_
    complexed with dms, gen, nap

Details for d4fj1d_

PDB Entry: 4fj1 (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein
PDB Compounds: (D:) 17beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d4fj1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fj1d_ c.2.1.0 (D:) automated matches {Cochliobolus lunatus [TaxId: 5503]}
tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
lvskegewvngkvltldggaa

SCOPe Domain Coordinates for d4fj1d_:

Click to download the PDB-style file with coordinates for d4fj1d_.
(The format of our PDB-style files is described here.)

Timeline for d4fj1d_: