Lineage for d1f49f1 (1f49 F:220-333)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551088Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 551089Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 551090Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 551091Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
  8. 551246Domain d1f49f1: 1f49 F:220-333 [22123]
    Other proteins in same PDB: d1f49a3, d1f49a4, d1f49a5, d1f49b3, d1f49b4, d1f49b5, d1f49c3, d1f49c4, d1f49c5, d1f49d3, d1f49d4, d1f49d5, d1f49e3, d1f49e4, d1f49e5, d1f49f3, d1f49f4, d1f49f5, d1f49g3, d1f49g4, d1f49g5, d1f49h3, d1f49h4, d1f49h5

Details for d1f49f1

PDB Entry: 1f49 (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

SCOP Domain Sequences for d1f49f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f49f1 b.1.4.1 (F:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1f49f1:

Click to download the PDB-style file with coordinates for d1f49f1.
(The format of our PDB-style files is described here.)

Timeline for d1f49f1: