Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries) |
Domain d4ffwc1: 4ffw C:1-106 [221194] Other proteins in same PDB: d4ffwa1, d4ffwa2, d4ffwb1, d4ffwb2, d4ffwc2, d4ffwl2 automated match to d1sy6l1 complexed with 715 |
PDB Entry: 4ffw (more details), 2.9 Å
SCOPe Domain Sequences for d4ffwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ffwc1 b.1.1.0 (C:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qivlsqspailsaspgekvtmtcrasssvnnmhwyqqkpssspkpwlhgtsnlasgvpvr fsgsgsgtsfsltisrveaedaatyfcqqwsnhpptfgggtkleid
Timeline for d4ffwc1: