SCOPe 2.05: Domain d4ffwc1: 4ffw C:1-106

Lineage for d4ffwc1 (4ffw C:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d4ffwc1: 4ffw C:1-106 [221194]
   Other proteins in same PDB: d4ffwa1, d4ffwa2, d4ffwb1, d4ffwb2, d4ffwc2, d4ffwl2
   automated match to d1sy6l1
   complexed with 715

Details for d4ffwc1

PDB Entry: 4ffw, 2.9 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with fab + sitagliptin

PDB Compounds: (C:) Fab light chain

SCOPe Domain Sequences for d4ffwc1:

Sequence; same for both SEQRES and ATOM records:

>d4ffwc1 b.1.1.0 (C:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivlsqspailsaspgekvtmtcrasssvnnmhwyqqkpssspkpwlhgtsnlasgvpvr
fsgsgsgtsfsltisrveaedaatyfcqqwsnhpptfgggtkleid

Timeline for d4ffwc1:

• d4ffwc1 first appeared in SCOPe 2.03
  
• d4ffwc1 appears in SCOPe 2.04
  
• d4ffwc1 appears in SCOPe 2.06
  
• d4ffwc1 appears in the current release, SCOPe 2.08