Class b: All beta proteins [48724] (176 folds) |
Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) automatically mapped to Pfam PF00930 |
Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins) Pfam PF00930 |
Protein automated matches [226889] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [225089] (7 PDB entries) |
Domain d4ffwa1: 4ffw A:39-509 [221190] Other proteins in same PDB: d4ffwa2, d4ffwb2, d4ffwc1, d4ffwc2, d4ffwl1, d4ffwl2 automated match to d1orva1 complexed with 715 |
PDB Entry: 4ffw (more details), 2.9 Å
SCOPe Domain Sequences for d4ffwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ffwa1 b.70.3.1 (A:39-509) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifgd sisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsqe ghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspng tflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsstt ttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwncp ttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctfi tkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqyy svslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvq
Timeline for d4ffwa1: