Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.0: automated matches [227141] (1 protein) not a true family |
Protein automated matches [226843] (9 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224936] (2 PDB entries) |
Domain d4ffbb2: 4ffb B:244-432 [221164] Other proteins in same PDB: d4ffba1, d4ffbb1 automated match to d1jffb2 complexed with gtp, mg |
PDB Entry: 4ffb (more details), 2.88 Å
SCOPe Domain Sequences for d4ffbb2:
Sequence, based on SEQRES records: (download)
>d4ffbb2 d.79.2.0 (B:244-432) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gqlnsdlrklavnlvpfprlhffmvgyapltaigsqsfrsltvpeltqqmfdaknmmaaa dprngryltvaaffrgkvsvkevedemhkvqsknsdyfvewipnnvqtavcsvapqgldm aatfianstsiqelfkrvgdqfsamfkrkaflhwytsegmdelefseaesnmndlvseyq qyqeatved
>d4ffbb2 d.79.2.0 (B:244-432) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gqlnsdlrklavnlvpfprlhffmvgyapltaigsltvpeltqqmfdaknmmaaadprng ryltvaaffrgkvsvkevedemhkvqsknsdyfvewipnnvqtavcsvapqgldmaatfi anstsiqelfkrvgdqfsamfkrkaflhwytsegmdelefseaesnmndlvseyqqyqea tved
Timeline for d4ffbb2: