Lineage for d4ffbb2 (4ffb B:244-432)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2960042Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2960043Protein automated matches [226843] (9 species)
    not a true protein
  7. 2960057Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224936] (2 PDB entries)
  8. 2960059Domain d4ffbb2: 4ffb B:244-432 [221164]
    Other proteins in same PDB: d4ffba1, d4ffbb1
    automated match to d1jffb2
    complexed with gtp, mg

Details for d4ffbb2

PDB Entry: 4ffb (more details), 2.88 Å

PDB Description: A TOG:alpha/beta-tubulin Complex Structure Reveals Conformation-Based Mechanisms For a Microtubule Polymerase
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4ffbb2:

Sequence, based on SEQRES records: (download)

>d4ffbb2 d.79.2.0 (B:244-432) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gqlnsdlrklavnlvpfprlhffmvgyapltaigsqsfrsltvpeltqqmfdaknmmaaa
dprngryltvaaffrgkvsvkevedemhkvqsknsdyfvewipnnvqtavcsvapqgldm
aatfianstsiqelfkrvgdqfsamfkrkaflhwytsegmdelefseaesnmndlvseyq
qyqeatved

Sequence, based on observed residues (ATOM records): (download)

>d4ffbb2 d.79.2.0 (B:244-432) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gqlnsdlrklavnlvpfprlhffmvgyapltaigsltvpeltqqmfdaknmmaaadprng
ryltvaaffrgkvsvkevedemhkvqsknsdyfvewipnnvqtavcsvapqgldmaatfi
anstsiqelfkrvgdqfsamfkrkaflhwytsegmdelefseaesnmndlvseyqqyqea
tved

SCOPe Domain Coordinates for d4ffbb2:

Click to download the PDB-style file with coordinates for d4ffbb2.
(The format of our PDB-style files is described here.)

Timeline for d4ffbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ffbb1