SCOPe 2.03: Domain d4fdfa_: 4fdf A:

Lineage for d4fdfa_ (4fdf A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families)

5. Family d.58.21.0: automated matches [191458] (1 protein)
   not a true family

6. Protein automated matches [190706] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [226632] (1 PDB entry)

8. Domain d4fdfa_: 4fdf A: [221152]
   automated match to d2eeya_

Details for d4fdfa_

PDB Entry: 4fdf, 2.2 Å

PDB Description: structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv

PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein C 2

SCOPe Domain Sequences for d4fdfa_:

Sequence, based on SEQRES records:

>d4fdfa_ d.58.21.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gaahmvditekattkrtavaagilrtsaqvvalistgglpkgdalatarvagimaakrts
dliplchqlaltgvdvdftvgqldieitatvrstdrtgvemealtavsvaaltlydmika
vdpgaliddirvlhkeggrrgtwtrr

Sequence, based on observed residues (ATOM records):

>d4fdfa_ d.58.21.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gaahmvditkrtavaagilrtsaqvvalistgglpkgdalatarvagimaakrtsdlipl
chqlaltgvdvdftvgqldieitatvrstdrtgvemealtavsvaaltlydmikavdpga
liddirvlhketrr

Timeline for d4fdfa_:

• d4fdfa_ is new in SCOPe 2.03-stable
  
• d4fdfa_ appears in SCOPe 2.04
  
• d4fdfa_ appears in the current release, SCOPe 2.08