Lineage for d4fcra_ (4fcr A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2212983Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2212984Protein HSP90 [55876] (3 species)
  7. 2213070Species Human (Homo sapiens) [TaxId:9606] [55878] (93 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2213090Domain d4fcra_: 4fcr A: [221149]
    automated match to d1uy7a_
    complexed with 0tm

Details for d4fcra_

PDB Entry: 4fcr (more details), 1.7 Å

PDB Description: Targeting conserved water molecules: Design of 4-aryl-5-cyanopyrrolo[2,3-d]pyrimidine Hsp90 inhibitors using fragment-based screening and structure-based optimization
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d4fcra_:

Sequence, based on SEQRES records: (download)

>d4fcra_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfve

Sequence, based on observed residues (ATOM records): (download)

>d4fcra_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiasgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d4fcra_:

Click to download the PDB-style file with coordinates for d4fcra_.
(The format of our PDB-style files is described here.)

Timeline for d4fcra_: