SCOPe 2.08: Domain d4fcjb1: 4fcj B:1-138

Lineage for d4fcjb1 (4fcj B:1-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189642] (4 PDB entries)

8. Domain d4fcjb1: 4fcj B:1-138 [221144]
   Other proteins in same PDB: d4fcjb2
   automated match to d4fcma_
   complexed with gol

Details for d4fcjb1

PDB Entry: 4fcj, 1.62 Å

PDB Description: crystal structure of the ntf2-like domain of human g3bp1

PDB Compounds: (B:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d4fcjb1:

Sequence, based on SEQRES records:

>d4fcjb1 d.17.4.0 (B:1-138) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqke
ihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsv
ankfyvhndifryqdevf

Sequence, based on observed residues (ATOM records):

>d4fcjb1 d.17.4.0 (B:1-138) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhgglpadavygqkeihrkv
msqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapfyvhndifr
yqdevf

Timeline for d4fcjb1:

• d4fcjb1 first appeared in SCOPe 2.03, called d4fcjb_
  
• d4fcjb1 appears in SCOPe 2.07