Lineage for d4fccj2 (4fcc J:197-447)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580675Species Escherichia coli [TaxId:83334] [226481] (1 PDB entry)
  8. 1580685Domain d4fccj2: 4fcc J:197-447 [221136]
    Other proteins in same PDB: d4fcca1, d4fccb1, d4fccc1, d4fccd1, d4fcce1, d4fccf1, d4fccg1, d4fcch1, d4fcci1, d4fccj1, d4fcck1, d4fccl1
    automated match to d1bgva1

Details for d4fccj2

PDB Entry: 4fcc (more details), 2 Å

PDB Description: Glutamate dehydrogenase from E. coli
PDB Compounds: (J:) glutamate dehydrogenase

SCOPe Domain Sequences for d4fccj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fccj2 c.2.1.0 (J:197-447) automated matches {Escherichia coli [TaxId: 83334]}
kglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaqyaiekamefga
rvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvylegqqpwsvpvd
ialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfapgkaanagg
vatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtnyvqganiagfvk
vadamlaqgvi

SCOPe Domain Coordinates for d4fccj2:

Click to download the PDB-style file with coordinates for d4fccj2.
(The format of our PDB-style files is described here.)

Timeline for d4fccj2: