Lineage for d4fccf1 (4fcc F:6-196)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1376891Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1376892Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1377194Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 1377195Protein automated matches [226864] (18 species)
    not a true protein
  7. 1377226Species Escherichia coli [TaxId:83334] [226480] (1 PDB entry)
  8. 1377232Domain d4fccf1: 4fcc F:6-196 [221127]
    Other proteins in same PDB: d4fcca2, d4fccb2, d4fccc2, d4fccd2, d4fcce2, d4fccf2, d4fccg2, d4fcch2, d4fcci2, d4fccj2, d4fcck2, d4fccl2
    automated match to d1bgva2

Details for d4fccf1

PDB Entry: 4fcc (more details), 2 Å

PDB Description: Glutamate dehydrogenase from E. coli
PDB Compounds: (F:) glutamate dehydrogenase

SCOPe Domain Sequences for d4fccf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fccf1 c.58.1.0 (F:6-196) automated matches {Escherichia coli [TaxId: 83334]}
slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
lsnntacvftg

SCOPe Domain Coordinates for d4fccf1:

Click to download the PDB-style file with coordinates for d4fccf1.
(The format of our PDB-style files is described here.)

Timeline for d4fccf1: