Lineage for d4fc6c_ (4fc6 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847078Domain d4fc6c_: 4fc6 C: [221111]
    automated match to d2rhcb_
    complexed with hxc, nap

Details for d4fc6c_

PDB Entry: 4fc6 (more details), 2.1 Å

PDB Description: Studies on DCR shed new light on peroxisomal beta-oxidation: Crystal structure of the ternary complex of pDCR
PDB Compounds: (C:) Peroxisomal 2,4-dienoyl-CoA reductase

SCOPe Domain Sequences for d4fc6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fc6c_ c.2.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqpppdvegddclpayrhlfcpdllrdkvafitgggsgigfriaeifmrhgchtviasrs
lprvltaarklagatgrrclplsmdvrappavmaavdqalkefgridilincaagnflcp
agalsfnafktvmdidtsgtfnvsrvlyekffrdhggvivnitatlgnrgqalqvhagsa
kaavdamtrhlavewgpqnirvnslapgpisgteglrrlggpqaslstkvtasplqrlgn
kteiahsvlylasplasyvtgavlvadggawltfpn

SCOPe Domain Coordinates for d4fc6c_:

Click to download the PDB-style file with coordinates for d4fc6c_.
(The format of our PDB-style files is described here.)

Timeline for d4fc6c_: