Lineage for d4fbic_ (4fbi C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268494Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1268495Protein automated matches [190907] (3 species)
    not a true protein
  7. 1268496Species Enterobacter sp. [TaxId:211595] [189872] (11 PDB entries)
  8. 1268499Domain d4fbic_: 4fbi C: [221104]
    automated match to d4f8da_
    complexed with gol; mutant

Details for d4fbic_

PDB Entry: 4fbi (more details), 1.5 Å

PDB Description: Crystal Structure of an R46A mutant of the Restriction-Modification Controller Protein C.Esp1396I (Trigonal Form)
PDB Compounds: (C:) Regulatory protein

SCOPe Domain Sequences for d4fbic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fbic_ a.35.1.0 (C:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsanltikslelimkglev
sdvvffemlikeilk

SCOPe Domain Coordinates for d4fbic_:

Click to download the PDB-style file with coordinates for d4fbic_.
(The format of our PDB-style files is described here.)

Timeline for d4fbic_: