Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
Protein automated matches [190907] (3 species) not a true protein |
Species Enterobacter sp. [TaxId:211595] [189872] (11 PDB entries) |
Domain d4fbic_: 4fbi C: [221104] automated match to d4f8da_ complexed with gol; mutant |
PDB Entry: 4fbi (more details), 1.5 Å
SCOPe Domain Sequences for d4fbic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fbic_ a.35.1.0 (C:) automated matches {Enterobacter sp. [TaxId: 211595]} sfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsanltikslelimkglev sdvvffemlikeilk
Timeline for d4fbic_: