Lineage for d4f7ud_ (4f7u D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2786990Protein D2 core SNRNP protein [50186] (3 species)
    3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive
  7. 2787013Species Mouse (Mus musculus) [TaxId:10090] [224862] (1 PDB entry)
  8. 2787015Domain d4f7ud_: 4f7u D: [221065]
    Other proteins in same PDB: d4f7ua_, d4f7uc_, d4f7ue_, d4f7uf_, d4f7ug_, d4f7uh_, d4f7ui_, d4f7uj_
    automated match to d1b34b_
    complexed with p6g

Details for d4f7ud_

PDB Entry: 4f7u (more details), 1.9 Å

PDB Description: the 6s snrnp assembly intermediate
PDB Compounds: (D:) Small nuclear ribonucleoprotein Sm D2

SCOPe Domain Sequences for d4f7ud_:

Sequence, based on SEQRES records: (download)

>d4f7ud_ b.38.1.1 (D:) D2 core SNRNP protein {Mouse (Mus musculus) [TaxId: 10090]}
lqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwt
evpksgkgkkkskpvnkdryiskmflrgdsvivvlrnp

Sequence, based on observed residues (ATOM records): (download)

>d4f7ud_ b.38.1.1 (D:) D2 core SNRNP protein {Mouse (Mus musculus) [TaxId: 10090]}
lqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwt
evnkdryiskmflrgdsvivvlrnp

SCOPe Domain Coordinates for d4f7ud_:

Click to download the PDB-style file with coordinates for d4f7ud_.
(The format of our PDB-style files is described here.)

Timeline for d4f7ud_: