SCOPe 2.04: Domain d4f6eb1: 4f6e B:1-90

Lineage for d4f6eb1 (4f6e B:1-90)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (26 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226251] (2 PDB entries)

8. Domain d4f6eb1: 4f6e B:1-90 [221046]
   Other proteins in same PDB: d4f6ea2, d4f6eb2, d4f6ec2, d4f6ed2
   automated match to d1kkca1
   complexed with gol, mly, mn, trs; mutant

Details for d4f6eb1

PDB Entry: 4f6e, 1.6 Å

PDB Description: Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae

PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d4f6eb1:

Sequence; same for both SEQRES and ATOM records:

>d4f6eb1 a.2.11.0 (B:1-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlap

Timeline for d4f6eb1:

• d4f6eb1 first appeared in SCOPe 2.03
  
• d4f6eb1 appears in SCOPe 2.05
  
• d4f6eb1 appears in the current release, SCOPe 2.08