SCOPe 2.04: Domain d4f3xa_: 4f3x A:

Lineage for d4f3xa_ (4f3x A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (35 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [226320] (9 PDB entries)

8. Domain d4f3xa_: 4f3x A: [221014]
   automated match to d1bxsa_
   complexed with gol, nad

Details for d4f3xa_

PDB Entry: 4f3x, 2.01 Å

PDB Description: Crystal structure of putative aldehyde dehydrogenase from Sinorhizobium meliloti 1021 complexed with NAD

PDB Compounds: (A:) Putative aldehyde dehydrogenase

SCOPe Domain Sequences for d4f3xa_:

Sequence; same for both SEQRES and ATOM records:

>d4f3xa_ c.82.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mmdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqtt
paersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlh
apaageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtpl
talklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaakt
vkrthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvad
ltsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegff
fqptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskam
raasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg

Timeline for d4f3xa_:

• d4f3xa_ first appeared in SCOPe 2.03
  
• d4f3xa_ appears in SCOPe 2.05
  
• d4f3xa_ appears in the current release, SCOPe 2.08, called d4f3xa1