Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Escherichia coli [TaxId:562] [224856] (13 PDB entries) |
Domain d4f3fa1: 4f3f A:2-106 [221008] Other proteins in same PDB: d4f3fa2 automated match to d1dn0a1 |
PDB Entry: 4f3f (more details), 2.65 Å
SCOPe Domain Sequences for d4f3fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f3fa1 b.1.1.0 (A:2-106) automated matches {Escherichia coli [TaxId: 562]} dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkvei
Timeline for d4f3fa1: