Lineage for d1bglb2 (1bgl B:626-730)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1110264Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 1110265Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1110266Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1110280Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
    Uniprot P00722
  8. 1110428Domain d1bglb2: 1bgl B:626-730 [22100]
    Other proteins in same PDB: d1bgla3, d1bgla4, d1bgla5, d1bglb3, d1bglb4, d1bglb5, d1bglc3, d1bglc4, d1bglc5, d1bgld3, d1bgld4, d1bgld5, d1bgle3, d1bgle4, d1bgle5, d1bglf3, d1bglf4, d1bglf5, d1bglg3, d1bglg4, d1bglg5, d1bglh3, d1bglh4, d1bglh5
    complexed with mg

Details for d1bglb2

PDB Entry: 1bgl (more details), 2.5 Å

PDB Description: beta-galactosidase (chains a-h)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1bglb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bglb2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d1bglb2:

Click to download the PDB-style file with coordinates for d1bglb2.
(The format of our PDB-style files is described here.)

Timeline for d1bglb2: