Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Burkholderia vietnamiensis [TaxId:269482] [226385] (2 PDB entries) |
Domain d4f32b2: 4f32 B:262-422 [220993] Other proteins in same PDB: d4f32b3 automated match to d1j3na2 complexed with edo, n32 |
PDB Entry: 4f32 (more details), 1.9 Å
SCOPe Domain Sequences for d4f32b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f32b2 c.95.1.0 (B:262-422) automated matches {Burkholderia vietnamiensis [TaxId: 269482]} rpiaeiigygttadayhmtagpddgsgamramklalrmgdvapeqvdyvnahatstpvgd ageiealktvfgvgagpaisstksatghllgaagaieaafsilalrdgvlpgtlnlehpd paadgldligpaarhvpveialsngfgfggvnasvlfrryp
Timeline for d4f32b2: