Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (25 species) not a true protein |
Species Leishmania major [TaxId:5664] [226381] (1 PDB entry) |
Domain d4f2nk2: 4f2n K:118-230 [220984] Other proteins in same PDB: d4f2na1, d4f2nb1, d4f2nc1, d4f2nd1, d4f2ne1, d4f2nf1, d4f2ng1, d4f2nh1, d4f2ni1, d4f2nj1, d4f2nk1, d4f2nl1 automated match to d1mnga2 complexed with fe2 |
PDB Entry: 4f2n (more details), 1.85 Å
SCOPe Domain Sequences for d4f2nk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f2nk2 d.44.1.0 (K:118-230) automated matches {Leishmania major [TaxId: 5664]} ggkpmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnag cpltsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
Timeline for d4f2nk2: