SCOPe 2.03: Domain d4f2nh2: 4f2n H:118-230

Lineage for d4f2nh2 (4f2n H:118-230)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (25 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [226381] (1 PDB entry)

8. Domain d4f2nh2: 4f2n H:118-230 [220978]
   Other proteins in same PDB: d4f2na1, d4f2nb1, d4f2nc1, d4f2nd1, d4f2ne1, d4f2nf1, d4f2ng1, d4f2nh1, d4f2ni1, d4f2nj1, d4f2nk1, d4f2nl1
   automated match to d1mnga2
   complexed with fe2

Details for d4f2nh2

PDB Entry: 4f2n, 1.85 Å

PDB Description: crystal structure of iron superoxide dismutase from leishmania major

PDB Compounds: (H:) superoxide dismutase

SCOPe Domain Sequences for d4f2nh2:

Sequence; same for both SEQRES and ATOM records:

>d4f2nh2 d.44.1.0 (H:118-230) automated matches {Leishmania major [TaxId: 5664]}
ggkpmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnag
cpltsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk

Timeline for d4f2nh2:

• d4f2nh2 is new in SCOPe 2.03-stable
  
• d4f2nh2 appears in SCOPe 2.04
  
• d4f2nh2 appears in the current release, SCOPe 2.08