Lineage for d4f15c1 (4f15 C:1-110)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767269Domain d4f15c1: 4f15 C:1-110 [220937]
    Other proteins in same PDB: d4f15c2, d4f15f2, d4f15i2, d4f15l2
    automated match to d1dqdl1

Details for d4f15c1

PDB Entry: 4f15 (more details), 2.81 Å

PDB Description: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses
PDB Compounds: (C:) Fab fragment, light chain

SCOPe Domain Sequences for d4f15c1:

Sequence, based on SEQRES records: (download)

>d4f15c1 b.1.1.0 (C:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqmtqspaslavspgqratitcrasesvsnyginfinwfqqkpgqppklliytasnkgtg
vparfsgsgsgtdftltinpveaedtanyfcqqtkevpygtfggtkleik

Sequence, based on observed residues (ATOM records): (download)

>d4f15c1 b.1.1.0 (C:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqmtqspaslavspgqratitcrasesvsnfinwfqqkpgqppklliytasnkgtgvpar
fsgsgsgtdftltinpveaedtanyfcqqtkevpygtfggtkleik

SCOPe Domain Coordinates for d4f15c1:

Click to download the PDB-style file with coordinates for d4f15c1.
(The format of our PDB-style files is described here.)

Timeline for d4f15c1: