Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein automated matches [190066] (5 species) not a true protein |
Species Red algae (Galdieria sulphuraria) [TaxId:130081] [193382] (3 PDB entries) |
Domain d4f0mb_: 4f0m B: [220934] Other proteins in same PDB: d4f0ma1, d4f0ma2 automated match to d4f0kb_ complexed with cl, gol, mg |
PDB Entry: 4f0m (more details), 2.25 Å
SCOPe Domain Sequences for d4f0mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0mb_ d.73.1.1 (B:) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]} mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnsfwemwglplfevtd papvlfeinacrkaksnfyikvvgfssergiestiisfivnrpkhepgfnlirqedksrs ikysiqayetykpedqry
Timeline for d4f0mb_: