Lineage for d4f0mb_ (4f0m B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656663Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1656664Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1656665Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1656823Protein automated matches [190066] (5 species)
    not a true protein
  7. 1656901Species Red algae (Galdieria sulphuraria) [TaxId:130081] [193382] (3 PDB entries)
  8. 1656904Domain d4f0mb_: 4f0m B: [220934]
    Other proteins in same PDB: d4f0ma1, d4f0ma2
    automated match to d4f0kb_
    complexed with cl, gol, mg

Details for d4f0mb_

PDB Entry: 4f0m (more details), 2.25 Å

PDB Description: unactivated rubisco with magnesium and a water molecule bound
PDB Compounds: (B:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d4f0mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f0mb_ d.73.1.1 (B:) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]}
mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnsfwemwglplfevtd
papvlfeinacrkaksnfyikvvgfssergiestiisfivnrpkhepgfnlirqedksrs
ikysiqayetykpedqry

SCOPe Domain Coordinates for d4f0mb_:

Click to download the PDB-style file with coordinates for d4f0mb_.
(The format of our PDB-style files is described here.)

Timeline for d4f0mb_: