Lineage for d4f0ca1 (4f0c A:2-92)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879185Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries)
  8. 2879202Domain d4f0ca1: 4f0c A:2-92 [220924]
    Other proteins in same PDB: d4f0ca2
    automated match to d1k0db2
    complexed with gds, gol, so4

Details for d4f0ca1

PDB Entry: 4f0c (more details), 1.9 Å

PDB Description: crystal structure of the glutathione transferase ure2p5 from phanerochaete chrysosporium
PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d4f0ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f0ca1 c.47.1.0 (A:2-92) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
shgkqftlfnhqvgpngwkvdmllrelglsfetvyvnlgqrehkspsftkynpngripal
idhyyndfvvwesdaillyivekydpehkfs

SCOPe Domain Coordinates for d4f0ca1:

Click to download the PDB-style file with coordinates for d4f0ca1.
(The format of our PDB-style files is described here.)

Timeline for d4f0ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f0ca2