Lineage for d4f04d1 (4f04 D:11-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949509Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2949510Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2949511Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2949512Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
    Uniprot P00478
  8. 2949582Domain d4f04d1: 4f04 D:11-100 [220921]
    Other proteins in same PDB: d4f04a1, d4f04a2, d4f04b2, d4f04c1, d4f04c2, d4f04d2
    automated match to d1d09b1
    complexed with pal, utp, zn

Details for d4f04d1

PDB Entry: 4f04 (more details), 2.3 Å

PDB Description: a second allosteric site in e. coli aspartate transcarbamoylase: r- state atcase with utp bound
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4f04d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f04d1 d.58.2.1 (D:11-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq
vdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d4f04d1:

Click to download the PDB-style file with coordinates for d4f04d1.
(The format of our PDB-style files is described here.)

Timeline for d4f04d1: