Lineage for d4ewjb1 (4ewj B:1-137)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649717Species Streptococcus suis [TaxId:1307] [226501] (1 PDB entry)
  8. 1649719Domain d4ewjb1: 4ewj B:1-137 [220895]
    Other proteins in same PDB: d4ewja2, d4ewjb2
    automated match to d1w6ta2

Details for d4ewjb1

PDB Entry: 4ewj (more details), 2.4 Å

PDB Description: structure of the enloase from Streptococcus suis serotype 2
PDB Compounds: (B:) Enolase 2

SCOPe Domain Sequences for d4ewjb1:

Sequence, based on SEQRES records: (download)

>d4ewjb1 d.54.1.0 (B:1-137) automated matches {Streptococcus suis [TaxId: 1307]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl
glgtqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavar
aaadylevplytylggf

Sequence, based on observed residues (ATOM records): (download)

>d4ewjb1 d.54.1.0 (B:1-137) automated matches {Streptococcus suis [TaxId: 1307]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsggeheavelrdgdksrylglg
tqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavaraaa
dylevplytylggf

SCOPe Domain Coordinates for d4ewjb1:

Click to download the PDB-style file with coordinates for d4ewjb1.
(The format of our PDB-style files is described here.)

Timeline for d4ewjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ewjb2