SCOPe 2.05: Domain d4ewja1: 4ewj A:1-137

Lineage for d4ewja1 (4ewj A:1-137)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Streptococcus suis [TaxId:1307] [226501] (1 PDB entry)

8. Domain d4ewja1: 4ewj A:1-137 [220893]
   Other proteins in same PDB: d4ewja2, d4ewjb2
   automated match to d1w6ta2

Details for d4ewja1

PDB Entry: 4ewj, 2.4 Å

PDB Description: structure of the enloase from Streptococcus suis serotype 2

PDB Compounds: (A:) Enolase 2

SCOPe Domain Sequences for d4ewja1:

Sequence, based on SEQRES records:

>d4ewja1 d.54.1.0 (A:1-137) automated matches {Streptococcus suis [TaxId: 1307]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl
glgtqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavar
aaadylevplytylggf

Sequence, based on observed residues (ATOM records):

>d4ewja1 d.54.1.0 (A:1-137) automated matches {Streptococcus suis [TaxId: 1307]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsggeheavelrdgdksrylglg
tqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavaraaa
dylevplytylggf

Timeline for d4ewja1:

• d4ewja1 first appeared in SCOPe 2.03
  
• d4ewja1 appears in SCOPe 2.04
  
• d4ewja1 appears in SCOPe 2.06
  
• d4ewja1 appears in the current release, SCOPe 2.08