SCOPe 2.08: Domain d4evnj1: 4evn J:3-112

Lineage for d4evnj1 (4evn J:3-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4evnj1: 4evn J:3-112 [220874]
   Other proteins in same PDB: d4evnb2, d4evnd2, d4evnf2, d4evnh2, d4evnj2, d4evnl2, d4evnn2, d4evnp2
   automated match to d2mcg11

Details for d4evnj1

PDB Entry: 4evn, 2.85 Å

PDB Description: crystal structure of fab cr6261 (somatic heavy chain with germline- reverted light chain)

PDB Compounds: (J:) Fab Lambda Light Chain

SCOPe Domain Sequences for d4evnj1:

Sequence; same for both SEQRES and ATOM records:

>d4evnj1 b.1.1.0 (J:3-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlg

Timeline for d4evnj1:

• d4evnj1 first appeared in SCOPe 2.03
  
• d4evnj1 appears in SCOPe 2.07