Lineage for d4evnh1 (4evn H:3-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033532Domain d4evnh1: 4evn H:3-112 [220872]
    Other proteins in same PDB: d4evnb2, d4evnd2, d4evnf2, d4evnh2, d4evnj2, d4evnl2, d4evnn2, d4evnp2
    automated match to d2mcg11

Details for d4evnh1

PDB Entry: 4evn (more details), 2.85 Å

PDB Description: crystal structure of fab cr6261 (somatic heavy chain with germline- reverted light chain)
PDB Compounds: (H:) Fab Lambda Light Chain

SCOPe Domain Sequences for d4evnh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4evnh1 b.1.1.0 (H:3-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlg

SCOPe Domain Coordinates for d4evnh1:

Click to download the PDB-style file with coordinates for d4evnh1.
(The format of our PDB-style files is described here.)

Timeline for d4evnh1: