SCOPe 2.04: Domain d4evnf2: 4evn F:113-215

Lineage for d4evnf2 (4evn F:113-215)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d4evnf2: 4evn F:113-215 [220871]
   Other proteins in same PDB: d4evnb1, d4evnd1, d4evnf1, d4evnh1, d4evnj1, d4evnl1, d4evnn1, d4evnp1
   automated match to d2fb4l2

Details for d4evnf2

PDB Entry: 4evn, 2.85 Å

PDB Description: crystal structure of fab cr6261 (somatic heavy chain with germline- reverted light chain)

PDB Compounds: (F:) Fab Lambda Light Chain

SCOPe Domain Sequences for d4evnf2:

Sequence; same for both SEQRES and ATOM records:

>d4evnf2 b.1.1.2 (F:113-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d4evnf2:

• d4evnf2 first appeared in SCOPe 2.03
  
• d4evnf2 appears in SCOPe 2.05
  
• d4evnf2 appears in the current release, SCOPe 2.08