Lineage for d4eu9b1 (4eu9 B:2-230)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169412Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2169413Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2169699Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2169700Protein automated matches [191112] (14 species)
    not a true protein
  7. 2169705Species Acetobacter aceti [TaxId:435] [226493] (17 PDB entries)
  8. 2169708Domain d4eu9b1: 4eu9 B:2-230 [220834]
    Other proteins in same PDB: d4eu9a3
    automated match to d2g39a1
    complexed with cl, coa

Details for d4eu9b1

PDB Entry: 4eu9 (more details), 1.48 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6-r228e) in complex with coa and a covalent glutamyl-coa thioester adduct
PDB Compounds: (B:) Succinyl-CoA:acetate coenzyme A transferase

SCOPe Domain Sequences for d4eu9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eu9b1 c.124.1.0 (B:2-230) automated matches {Acetobacter aceti [TaxId: 435]}
terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdena

SCOPe Domain Coordinates for d4eu9b1:

Click to download the PDB-style file with coordinates for d4eu9b1.
(The format of our PDB-style files is described here.)

Timeline for d4eu9b1: