SCOPe 2.05: Domain d4eu5a1: 4eu5 A:2-229

Lineage for d4eu5a1 (4eu5 A:2-229)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (11 species)
   not a true protein

7. Species Acetobacter aceti [TaxId:435] [226493] (12 PDB entries)

8. Domain d4eu5a1: 4eu5 A:2-229 [220816]
   automated match to d2g39a1
   complexed with cl, coa

Details for d4eu5a1

PDB Entry: 4eu5, 1.74 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6) in complex with coa

PDB Compounds: (A:) Succinyl-CoA:acetate coenzyme A transferase

SCOPe Domain Sequences for d4eu5a1:

Sequence; same for both SEQRES and ATOM records:

>d4eu5a1 c.124.1.0 (A:2-229) automated matches {Acetobacter aceti [TaxId: 435]}
terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrn

Timeline for d4eu5a1:

• d4eu5a1 first appeared in SCOPe 2.03
  
• d4eu5a1 appears in SCOPe 2.04
  
• d4eu5a1 appears in SCOPe 2.06
  
• d4eu5a1 appears in the current release, SCOPe 2.08