SCOPe 2.06: Domain d4eu3b2: 4eu3 B:230-505

Lineage for d4eu3b2 (4eu3 B:230-505)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (14 species)
   not a true protein

7. Species Acetobacter aceti [TaxId:435] [226493] (17 PDB entries)

8. Domain d4eu3b2: 4eu3 B:230-505 [220811]
   Other proteins in same PDB: d4eu3a3
   automated match to d2g39a2
   complexed with cit, cl

Details for d4eu3b2

PDB Entry: 4eu3, 1.58 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6) in complex with citrate (subunit b) or unliganded (subunit a)

PDB Compounds: (B:) Succinyl-CoA:acetate coenzyme A transferase

SCOPe Domain Sequences for d4eu3b2:

Sequence; same for both SEQRES and ATOM records:

>d4eu3b2 c.124.1.0 (B:230-505) automated matches {Acetobacter aceti [TaxId: 435]}
apfaapdetakaiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenl
vgyseviqdgmlamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnsp
giirrlgciamngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakg
gkisaivpmaahvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdy
fdralknsfgkhtphlltealswhqrfidtgtmlps

Timeline for d4eu3b2:

• d4eu3b2 first appeared in SCOPe 2.03
  
• d4eu3b2 appears in SCOPe 2.05
  
• d4eu3b2 appears in SCOPe 2.07
  
• d4eu3b2 appears in the current release, SCOPe 2.08